Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G32420_circ_g.15 |
ID in PlantcircBase | ath_circ_034072 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 15651880-15652156 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | AT4G32420 |
Parent gene annotation |
Peptidyl-prolyl cis-trans isomerase CYP95 |
Parent gene strand | - |
Alternative splicing | AT4G32420_circ_g.3 AT4G32420_circ_g.4 AT4G32420_circ_g.5 AT4G32420_circ_g.6 AT4G32420_circ_g.7 AT4G32420_circ_g.8 AT4G32420_circ_g.9 AT4G32420_circ_g.10 AT4G32420_circ_g.11 AT4G32420_circ_g.12 AT4G32420_circ_g.13 AT4G32420_circ_g.14 |
Support reads | 6 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G32420.4:2 AT4G32420.6:2 AT4G32420.1:2 AT4G32420.3:2 AT4G32420.5:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.187899368 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15652070-15651882(-) |
Potential amino acid sequence |
MYQLMEIQLRLWFLSFSLKSLPKHQRISVHYAQVIISGDPQVIISEAIPKTWQKRRIHRFLWMY QLMEIQLRLWFLSFSLKSLPKHQRISVHYAQVIISGDPQVIISEAIPKTWQKRRIHRFLWMYQL MEIQLRLWFLSFSLKSLPKHQRISVHYAQVIISGDPQVIISEAIPKTWQKRRIHRFLWMYQLME IQLRLWFLSFSLKSLPKHQRISVHYAQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |