Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0563800_circ_g.3 |
ID in PlantcircBase | osa_circ_040206 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 22410961-22411477 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0563800 |
Parent gene annotation |
ATPase, AAA-type, core domain containing protein. (Os09t0563800- 01) |
Parent gene strand | - |
Alternative splicing | Os09g0563800_circ_g.1 Os09g0563800_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0563800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018776 |
PMCS | 0.234171244 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22411140-22410989(+) 22411009-22411437(-) 22411453-22411450(-) |
Potential amino acid sequence |
MKLPIILLALPTTLERAGSSTIFICRGVAMTGCKIGGYRVSPTVFSSLPFQIMILVPEVICPVR QSQKGSP*(+) MLRHSSRTSLLTLSHRTNYLRDQDHDLER*(-) MIWKGSDEKTVGETLYPPILHPVIATPLQMKMVDDPALSNVVGRASKMIGNFMSYYTHLPHEAT KGKMTFLLHGPCDKKAVVEGIGRTLGLPVASVDASSLIKDFPSDSVSQDKLPQGPRS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |