Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.007G190200_circ_g.1 |
| ID in PlantcircBase | gra_circ_000742 |
| Alias | Chr07:18544421|18546641 |
| Organism | Gossypium raimondii |
| Position | chrChr07: 18544421-18546641 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.007G190200 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.007G190200.3:4 Gorai.007G190200.2:4 Gorai.007G190200.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.100612956 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18546049-18546636(-) 18544456-18546601(-) |
| Potential amino acid sequence |
MTEHVKERVVSLPSCVEIPTDGTDVWEIDARQLKIENRIASGSYADLYRGTYCSQEVAIKVLKP EQITREMLREFSQEVYIMRKIRHKNVVQFIGACTRSPNLCIVTGN*(-) MYKISKSVHCDWKLRSSKMHWRRKF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |