Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0476000_circ_g.5 |
ID in PlantcircBase | osa_circ_024214 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 23827582-23828398 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0476000 |
Parent gene annotation |
Tetratricopeptide-like helical domain containing protein. (Os04t 0476000-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0476000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005556* |
PMCS | 0.138017707 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23828262-23828339(+) |
Potential amino acid sequence |
MYNISLCYNYGEGFSQDQVRSKRWLQLAADCGHKKALYECGIKLCALIHPRLRKLLDGFIQLRL LAMLVLNTTWAFACRMGKESSVTSGKLQNGTCELQREEMCEPCTTFPCATTMVKDFHRIKCVQR GGCN*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |