Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0234600_circ_g.3 |
ID in PlantcircBase | osa_circ_023135 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 9075992-9076253 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0234600 |
Parent gene annotation |
Similar to Sedoheptulose-1,7-bisphosphatase. (Os04t0234600-01);S imilar to Sedoheptulose-1,7-bisphosphatase. (Os04t0234600-02);Si milar to Sedoheptulose-1,7-bisphosphatase. (Os04t0234600-03) |
Parent gene strand | - |
Alternative splicing | Os04g0234600_circ_g.4 Os04g0234600_circ_g.5 Os04g0234600_circ_g.6 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0234600-03:2 Os04t0234600-02:2 Os04t0234600-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.23027535 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9076060-9075996(+) 9076162-9076192(-) 9076208-9076187(-) |
Potential amino acid sequence |
MSLSYSGLSNVALRLPGENIFPSPMVVVSLTCCHFPG*(+) MTSSSTTMSRRSTHCVTLEEWFLMSTRKMAACQGHHNHWRGENVLSW*(-) MFSPGNLRATFDNPEYDKLINYYVKEKYTLRYTGGMVPDVNQENGSMSRTPQPLERGKCSLLVT *(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |