Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0234600_circ_g.3 |
| ID in PlantcircBase | osa_circ_023135 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 9075992-9076253 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0234600 |
| Parent gene annotation |
Similar to Sedoheptulose-1,7-bisphosphatase. (Os04t0234600-01);S imilar to Sedoheptulose-1,7-bisphosphatase. (Os04t0234600-02);Si milar to Sedoheptulose-1,7-bisphosphatase. (Os04t0234600-03) |
| Parent gene strand | - |
| Alternative splicing | Os04g0234600_circ_g.4 Os04g0234600_circ_g.5 Os04g0234600_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0234600-03:2 Os04t0234600-02:2 Os04t0234600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.23027535 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9076060-9075996(+) 9076162-9076192(-) 9076208-9076187(-) |
| Potential amino acid sequence |
MSLSYSGLSNVALRLPGENIFPSPMVVVSLTCCHFPG*(+) MTSSSTTMSRRSTHCVTLEEWFLMSTRKMAACQGHHNHWRGENVLSW*(-) MFSPGNLRATFDNPEYDKLINYYVKEKYTLRYTGGMVPDVNQENGSMSRTPQPLERGKCSLLVT *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |