Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0217400_circ_g.1 |
ID in PlantcircBase | osa_circ_018545 |
Alias | Os_ciR9113 |
Organism | Oryza sativa |
Position | chr3: 6180320-6180481 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os03g0217400 |
Parent gene annotation |
Conserved hypothetical protein. (Os03t0217400-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0217400-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.22781893 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6180419-6180414(+) 6180446-6180322(-) |
Potential amino acid sequence |
MEDELEMGHMVMVWKIATSVVLCNFRVVEHQEVLSILILDLELHRTSPWTARR*(+) MPHLQFILHSPAGSPWRSPMQFQIQYQDTEDLLVLHHSEVTKNYGSCYLPHHHHMPHLQFILHS PAGSPWRSPMQFQIQYQDTEDLLVLHHSEVTKNYGSCYLPHHHHMPHLQFILHSPAGSPWRSPM QFQIQYQDTEDLLVLHHSEVTKNYGSCYLPHHHHMPHLQFILHSPAGSPWRSPMQFQIQYQDTE DLLVLHHSEVT(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |