Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G58560_circ_g.4 |
ID in PlantcircBase | ath_circ_028127 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 21652349-21652432 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G58560 |
Parent gene annotation |
Carbon catabolite repressor protein 4 homolog 1 |
Parent gene strand | - |
Alternative splicing | 3_circ_ag.5 AT3G58530_circ_g.1 AT3G58530_circ_g.2 AT3G58530_circ_g.3 AT3G58530_circ_g.4 AT3G58530_circ_g.5 AT3G58560_circ_g.1 AT3G58560_circ_g.2 AT3G58560_circ_g.3 AT3G58570_circ_g.1 AT3G58570_circ_g.2 AT3G58570_circ_g.3 AT3G58570_circ_g.4 AT3G58570_circ_g.5 |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G58560.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.233134921 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21652425-21652429(+) |
Potential amino acid sequence |
MKTSYFFTCENLSLLKKVAHPSIVFVLPMKTSYFFTCENLSLLKKVAHPSIVFVLPMKTSYFFT CENLSLLKKVAHPSIVFVLPMK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |