Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G58560_circ_g.4 |
| ID in PlantcircBase | ath_circ_028127 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 21652349-21652432 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G58560 |
| Parent gene annotation |
Carbon catabolite repressor protein 4 homolog 1 |
| Parent gene strand | - |
| Alternative splicing | 3_circ_ag.5 AT3G58530_circ_g.1 AT3G58530_circ_g.2 AT3G58530_circ_g.3 AT3G58530_circ_g.4 AT3G58530_circ_g.5 AT3G58560_circ_g.1 AT3G58560_circ_g.2 AT3G58560_circ_g.3 AT3G58570_circ_g.1 AT3G58570_circ_g.2 AT3G58570_circ_g.3 AT3G58570_circ_g.4 AT3G58570_circ_g.5 |
| Support reads | 1 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G58560.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.233134921 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21652425-21652429(+) |
| Potential amino acid sequence |
MKTSYFFTCENLSLLKKVAHPSIVFVLPMKTSYFFTCENLSLLKKVAHPSIVFVLPMKTSYFFT CENLSLLKKVAHPSIVFVLPMK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |