Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G09360_circ_g.3 |
| ID in PlantcircBase | ath_circ_020666 |
| Alias | At_ciR2152 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 2877316-2877623 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT3G09360 |
| Parent gene annotation |
Cyclin/Brf1-like TBP-binding protein |
| Parent gene strand | + |
| Alternative splicing | AT3G09360_circ_g.4 |
| Support reads | 4 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G09360.3:2 AT3G09360.1:2 AT3G09360.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.167328042 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2877376-2877620(+) |
| Potential amino acid sequence |
MNKDYLEEQAAKEAALKAASEALKASNSNCPEDARKAFEAAKADAAKSRKVNGYINNEEETHYK TITWTEMNKDYLEEQAAKEAALKAASEALKASNSNCPEDARKAFEAAKADAAKSRKVNGYINNE EETHYKTITWTEMNKDYLEEQAAKEAALKAASEALKASNSNCPEDARKAFEAAKADAAKSRKVN GYINNEEETHYKTITWTEMNKDYLEEQAAKEAALKAASEALKASNSNCPEDARKAFEAAKADAA KSRK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |