Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0678700_circ_g.2 |
ID in PlantcircBase | osa_circ_003227 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 27926231-27926371 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os01g0678700 |
Parent gene annotation |
DP protein. (Os01t0678700-01) |
Parent gene strand | - |
Alternative splicing | Os01g0678700_circ_g.1 Os01g0678700_circ_g.3 |
Support reads | 2 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0678700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.369562648 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27926320-27926258(+) 27926277-27926233(-) |
Potential amino acid sequence |
MSTLKASYTLRLIFFSSNSNFCIFSYL*(+) MGLTNYRYEKIQKLEFDEKNIRRRVYDAFNVLIAIRVIAKDKKEIKWMGLTNYRYEKIQKLEFD EKNIRRRVYDAFNVLIAIRVIAKDKKEIKWMGLTNYRYEKIQKLEFDEKNIRRRVYDAFNVLIA IRVIAKDKKEIKWMGLTNYRYEKIQKLE(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |