Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0593200_circ_g.2 |
ID in PlantcircBase | osa_circ_020584 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 22025348-22026434 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os03g0593200 |
Parent gene annotation |
Similar to CBS domain containing protein, expressed. (Os03t05932 00-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0593200-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004945* |
PMCS | 0.240714029 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22026402-22025350(-) |
Potential amino acid sequence |
MLRGAELSGAIAEDEQDMIENVLEIKDTHVREVMTPLVDVVAIDATATLIDFKNLWETHQYSSE PYVTEDELKLMLRGAELSGAIAEDEQDMIENVLEIKDTHVREVMTPLVDVVAIDATATLIDFKN LWETHQYSSEPYVTEDELKLMLRGAELSGAIAEDEQDMIENVLEIKDTHVREVMTPLVDVVAID ATATLIDFKNLWETHQYSSEPYVTEDELKLMLRGAELSGAIAEDEQDMIENVLEIKDTHVREVM TPLVDVVAIDATATLIDFKNLWETHQYS(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |