Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0957900_circ_g.1 |
ID in PlantcircBase | osa_circ_005881 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 42217681-42218203 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0957900 |
Parent gene annotation |
Armadillo-type fold domain containing protein. (Os01t0957900-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0957900-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.400854955 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
42217775-42217754(+) 42217792-42218202(-) |
Potential amino acid sequence |
MFDKHIASVKNHVNLNSDASEGKEMEAANMLSAMVVVVPYLSKKAMKTVFSEVYQLLTPCFSPL TRHVLKLMETLLDHLKAENVESDLVNLIPLLLAYLNYDEKKPDDTIVAALKLMKNCLAKLVGRP NLWMEVLPSAFEAVSGSKVCTGECGEAICALETMWLWEES*(+) MCLSNMPIAALLTFFPQPHCFKCANSFSTLSCAHLRT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |