Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0208500_circ_g.7 |
| ID in PlantcircBase | osa_circ_033190 |
| Alias | Os_ciR11294 |
| Organism | Oryza sativa |
| Position | chr7: 5857292-5857542 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0208500 |
| Parent gene annotation |
Similar to Cellulose synthase-4. (Os07t0208500-01);Cellulose syn thase domain containing protein. (Os07t0208500-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0208500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.363944688 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5857412-5857505(-) 5857431-5857413(-) |
| Potential amino acid sequence |
MLGVVETSAVPSMTVARSGSPSMTVARSLGDTSLQSLIAREPGDPWGGRRGY*(-) MRSWRMNAGGGGDVGRPKYDSGEIGLTKYDSGEIPRGYIPSVTNSQGARRSVGRKARILMLMMS VTTTTLHLAVPTRSRRLLIGCAVGA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |