Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G15340_circ_g.3 |
ID in PlantcircBase | ath_circ_021897 |
Alias | At_ciR5930 |
Organism | Arabidpsis thaliana |
Position | chr3: 5161725-5161901 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | AT3G15340 |
Parent gene annotation |
PPI2 |
Parent gene strand | - |
Alternative splicing | AT3G15340_circ_g.1 AT3G15340_circ_g.2 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G15340.1:1 AT3G15340.3:1 AT3G15340.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.152071571 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5161875-5161727(-) |
Potential amino acid sequence |
MKSLVSKSEGYRVVIEEKKMEFDALHESLRNLRCSTSDQLCFSKEELDHLAEILSLFGQMKSLV SKSEGYRVVIEEKKMEFDALHESLRNLRCSTSDQLCFSKEELDHLAEILSLFGQMKSLVSKSEG YRVVIEEKKMEFDALHESLRNLRCSTSDQLCFSKEELDHLAEILSLFGQMKSLVSKSEGYRVVI EEKKMEFDALHESLRNLRCSTSDQLCFSKEELDHL(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |