Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G15340_circ_g.3 |
| ID in PlantcircBase | ath_circ_021897 |
| Alias | At_ciR5930 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 5161725-5161901 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | AT3G15340 |
| Parent gene annotation |
PPI2 |
| Parent gene strand | - |
| Alternative splicing | AT3G15340_circ_g.1 AT3G15340_circ_g.2 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G15340.1:1 AT3G15340.3:1 AT3G15340.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.152071571 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5161875-5161727(-) |
| Potential amino acid sequence |
MKSLVSKSEGYRVVIEEKKMEFDALHESLRNLRCSTSDQLCFSKEELDHLAEILSLFGQMKSLV SKSEGYRVVIEEKKMEFDALHESLRNLRCSTSDQLCFSKEELDHLAEILSLFGQMKSLVSKSEG YRVVIEEKKMEFDALHESLRNLRCSTSDQLCFSKEELDHLAEILSLFGQMKSLVSKSEGYRVVI EEKKMEFDALHESLRNLRCSTSDQLCFSKEELDHL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |