Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d043052_circ_g.1 |
ID in PlantcircBase | zma_circ_007751 |
Alias | Zm03circ00074 |
Organism | Zea mays |
Position | chr3: 187600772-187602722 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d043052 |
Parent gene annotation |
Endoplasmic reticulum vesicle transporter protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d043052_T002:3 Zm00001d043052_T003:3 Zm00001d043052_T008:3 Zm00001d043052_T007:3 Zm00001d043052_T009:3 Zm00001d043052_T001:3 Zm00001d043052_T010:3 Zm00001d043052_T004:3 Zm00001d043052_T006:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.082443018 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
187602611-187600790(+) 187600841-187600840(+) 187601046-187602715(-) |
Potential amino acid sequence |
MLSTSSHLAQSIQELTTHWMILQGYFMTQVEPSNTISRPRTGAS*(+) MIKSVKQALGNGEGCRVYGTLDVQRVAGNFHISVHGLNIFVAEKIFEGSSHVNVSHVIHELSFG PKYPGIDNPLDDTSRILHDTSGTFKYYIKTTNRSIMMNKRSMNKPSTKKHRK*(+) MEVTSHPLHIQRPIDSTPFTISQCLFDTLDHFLCFFVEGLFMLLLFIMMLLFVVLI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |