Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0687700_circ_g.1 |
ID in PlantcircBase | osa_circ_003347 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 28372247-28372687 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0687700 |
Parent gene annotation |
Protein of unknown function DUF292, eukaryotic domain containing protein. (Os01t0687700-01) |
Parent gene strand | - |
Alternative splicing | Os01g0687700_circ_g.2 |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0687700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.229110941 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28372610-28372654(-) 28372313-28372654(-) |
Potential amino acid sequence |
MHLRTLFTTKYGKEFVAAAMELRPDSGVNRTIIEKLSVKAPSAESKLKVLKAIAQEYGLEWDSS NTEAELNKKYEDLLGMPLRTTGSNS*(-) MALNGTHRILKQSLTRNTKICWECPFELREAIASIIFASGRCSDLPELMHLRTLFTTKYGKEFV AAAMELRPDSGVNRTIIEKLSVKAPSAESKLKVLKAIAQEYGLEWDSSNTEAELNKKYEDLLGM PLRTTGSNS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |