Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0687700_circ_g.1 |
| ID in PlantcircBase | osa_circ_003347 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 28372247-28372687 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0687700 |
| Parent gene annotation |
Protein of unknown function DUF292, eukaryotic domain containing protein. (Os01t0687700-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0687700_circ_g.2 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0687700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.229110941 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28372610-28372654(-) 28372313-28372654(-) |
| Potential amino acid sequence |
MHLRTLFTTKYGKEFVAAAMELRPDSGVNRTIIEKLSVKAPSAESKLKVLKAIAQEYGLEWDSS NTEAELNKKYEDLLGMPLRTTGSNS*(-) MALNGTHRILKQSLTRNTKICWECPFELREAIASIIFASGRCSDLPELMHLRTLFTTKYGKEFV AAAMELRPDSGVNRTIIEKLSVKAPSAESKLKVLKAIAQEYGLEWDSSNTEAELNKKYEDLLGM PLRTTGSNS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |