Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0132300_circ_g.3 |
ID in PlantcircBase | osa_circ_012992 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 1681448-1682771 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0132300 |
Parent gene annotation |
Similar to Erythrocyte membrane protein PFEMP3 (Fragment). (Os02 t0132300-01);Similar to Erythrocyte membrane protein PFEMP3 (Fra gment). (Os02t0132300-02);Similar to Erythrocyte membrane protei n PFEMP3 (Fragment). (Os02t0132300-03) |
Parent gene strand | + |
Alternative splicing | Os02g0132300_circ_g.4 Os02g0132300_circ_g.5 Os02g0132300_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0132300-03:4 Os02t0132300-01:4 Os02t0132300-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_011745 |
PMCS | 0.271035719 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1681501-1681464(+) 1682707-1681471(+) |
Potential amino acid sequence |
MISVLFIMQLASHATQADEATELASSCDCAEVPASQQIVSESSTAGSSTEHLVSCEIKPLGVDE DIETIDANEETHLVIQDCPQCRICLDNEGDDLIAPCHCKGTQKYVHRSCLDNWRSTKEGFAFSH CTECRAAFLLRANVPPDRWWLRLKFQLLVVRDHTLIFFIVQLVVALLGMLVYRFYGDELREMFG YEEHPYAFYAMARFNFNT*(+) MEMNYEKCLVMKSIHMLFMQWQDLISTHDW*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |