Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0132300_circ_g.3 |
| ID in PlantcircBase | osa_circ_012992 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 1681448-1682771 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0132300 |
| Parent gene annotation |
Similar to Erythrocyte membrane protein PFEMP3 (Fragment). (Os02 t0132300-01);Similar to Erythrocyte membrane protein PFEMP3 (Fra gment). (Os02t0132300-02);Similar to Erythrocyte membrane protei n PFEMP3 (Fragment). (Os02t0132300-03) |
| Parent gene strand | + |
| Alternative splicing | Os02g0132300_circ_g.4 Os02g0132300_circ_g.5 Os02g0132300_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0132300-03:4 Os02t0132300-01:4 Os02t0132300-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011745 |
| PMCS | 0.271035719 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1681501-1681464(+) 1682707-1681471(+) |
| Potential amino acid sequence |
MISVLFIMQLASHATQADEATELASSCDCAEVPASQQIVSESSTAGSSTEHLVSCEIKPLGVDE DIETIDANEETHLVIQDCPQCRICLDNEGDDLIAPCHCKGTQKYVHRSCLDNWRSTKEGFAFSH CTECRAAFLLRANVPPDRWWLRLKFQLLVVRDHTLIFFIVQLVVALLGMLVYRFYGDELREMFG YEEHPYAFYAMARFNFNT*(+) MEMNYEKCLVMKSIHMLFMQWQDLISTHDW*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |