Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d019721_circ_g.3 |
ID in PlantcircBase | zma_circ_009275 |
Alias | zma_circ_0002729 |
Organism | Zea mays |
Position | chr7: 53789014-53789452 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d019721 |
Parent gene annotation |
Triacylglycerol lipase 1 |
Parent gene strand | - |
Alternative splicing | Zm00001d019721_circ_g.2 Zm00001d019721_circ_g.4 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d019721_T003:2 Zm00001d019721_T002:2 Zm00001d019721_T001:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.237233306 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
53789406-53789115(+) 53789143-53789033(+) 53789128-53789135(-) |
Potential amino acid sequence |
MWNMLKRQKKAIIRLNLIMNRESRVAFTPTCATNISDPNIKTIVSKDISK*(+) MYLHPGKDRAEEKLEVQYYLQFHFCHVEYAEETKESHHPFEPYHEQRE*(+) MNNHLDISLLTMVLMFGSEMFVAHVGVKATLLSLFMIRFKRMMAFFCLFSIFHMAEMELQIILD LQFFFSTVFSRVEIHGS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |