Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0378900_circ_g.1 |
| ID in PlantcircBase | osa_circ_036889 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 17819934-17820056 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os08g0378900 |
| Parent gene annotation |
Similar to Thioredoxin protein. (Os08t0378900-01);Similar to Thi oredoxin protein. (Os08t0378900-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 5 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0378900-01:1 Os08t0378900-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.281100136 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17819996-17819982(+) 17819956-17819936(-) |
| Potential amino acid sequence |
MRGTFLSPLTSSSSSLAVTFFISMSWAMRTQGPHHVA*(+) MAQDIEMKKVTAKELEELVRGERKVPLIVDFYATWCGPCVLMAQDIEMKKVTAKELEELVRGER KVPLIVDFYATWCGPCVLMAQDIEMKKVTAKELEELVRGERKVPLIVDFYATWCGPCVLMAQDI EM(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |