Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0216900_circ_g.5 |
| ID in PlantcircBase | osa_circ_008866 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 6105182-6105450 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0216900 |
| Parent gene annotation |
Similar to IDI2. (Os11t0216900-01);Similar to IDI2. (Os11t021690 0-02);Similar to IDI2. (Os11t0216900-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0216900-03:1 Os11t0216900-02:1 Os11t0216900-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.34635189 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6105236-6105251(-) |
| Potential amino acid sequence |
MLRRNGEVVCANLVSSITFSVMIAVIRFAGVTSKAGFHTDIPDAATCLPRPPSEFSNSLGDLSS ITICSPDGRERSIEVIGAAT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |