Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0614500_circ_g.2 |
| ID in PlantcircBase | osa_circ_015508 |
| Alias | Os02circ18448 |
| Organism | Oryza sativa |
| Position | chr2: 24271521-24272883 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os02g0614500 |
| Parent gene annotation |
Protein of unknown function DUF250 domain containing protein. (O s02t0614500-01);Similar to integral membrane protein like. (Os02 t0614500-02) |
| Parent gene strand | - |
| Alternative splicing | Os02g0614500_circ_g.1 Os02g0614500_circ_g.3 |
| Support reads | 2/1 |
| Tissues | panicle/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0614500-01:4 Os02t0614500-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004098* osi_circ_012006 |
| PMCS | 0.311947316 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24272766-24271536(+) 24272855-24272865(-) |
| Potential amino acid sequence |
MMIPTDVTTLNIHAPASSTAFLSALFAGAILSYHVEYNPIVTIVV*(+) MAPANKAERKAVLDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLMTLVMKW LGHIQPSYLPLPELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCILEILFDKVRYS RNTKLSIVLVLVGVAVCTVTDVSVNSKGLLAAVIAVWSTALQQHYVHHLQKKYSLGSFNLLGHT APAQAASLLILGPFVDFWLTNRRVDTFNYTTIVTIGLYST*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |