Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0614500_circ_g.2 |
ID in PlantcircBase | osa_circ_015508 |
Alias | Os02circ18448 |
Organism | Oryza sativa |
Position | chr2: 24271521-24272883 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl |
Parent gene | Os02g0614500 |
Parent gene annotation |
Protein of unknown function DUF250 domain containing protein. (O s02t0614500-01);Similar to integral membrane protein like. (Os02 t0614500-02) |
Parent gene strand | - |
Alternative splicing | Os02g0614500_circ_g.1 Os02g0614500_circ_g.3 |
Support reads | 2/1 |
Tissues | panicle/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0614500-01:4 Os02t0614500-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004098* osi_circ_012006 |
PMCS | 0.311947316 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24272766-24271536(+) 24272855-24272865(-) |
Potential amino acid sequence |
MMIPTDVTTLNIHAPASSTAFLSALFAGAILSYHVEYNPIVTIVV*(+) MAPANKAERKAVLDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLMTLVMKW LGHIQPSYLPLPELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCILEILFDKVRYS RNTKLSIVLVLVGVAVCTVTDVSVNSKGLLAAVIAVWSTALQQHYVHHLQKKYSLGSFNLLGHT APAQAASLLILGPFVDFWLTNRRVDTFNYTTIVTIGLYST*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |