Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0180600_circ_g.1 |
| ID in PlantcircBase | osa_circ_026865 |
| Alias | Os05circ04473 |
| Organism | Oryza sativa |
| Position | chr5: 4854826-4854970 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os05g0180600 |
| Parent gene annotation |
Similar to Phosphatidylinositol 3-kinase, root isoform. (Os05t01 80600-01);Similar to Phosphatidylinositol 3-kinase, root isoform (EC 2.7.1.137) (PI3- kinase) (PtdIns-3-kinase) (PI3K) (SPI3K-5) . (Os05t0180600-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0180600-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.270693678 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4854881-4854907(-) 4854841-4854907(-) |
| Potential amino acid sequence |
MRRSNIPDITNEENAGLKPILHEIQVILLRSIQHFKEVQ*(-) MQALSQYYTRFKSYCCEAYNILRKSSSLILNLFNLMRRSNIPDITNEENAGLKPILHEIQVILL RSIQHFKEVQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |