Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0376900_circ_g.1 |
| ID in PlantcircBase | osa_circ_020060 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 14880043-14881381 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0376900 |
| Parent gene annotation |
Nucleotide-binding, alpha-beta plait domain containing protein. (Os03t0376900-01);Nucleotide-binding, alpha-beta plait domain co ntaining protein. (Os03t0376900-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0376900-02:4 Os03t0376900-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.221762827 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14880068-14880151(+) |
| Potential amino acid sequence |
MVSYFASSSEPAQIRGKTVYIQYSNRQEIVNNKSPGETAGNVLLVTIEGVQANDVTIDVIHLVF SAFGFVHKIATFEKAAGFQALIQYTDAATASAAREALDGRSIPRYLLPEHVTSCCLRISFSAHK DLNIKFQSHRSRLTLIKLFRWFLTLHHLRNQRKSEAKLFTFSIQTDKK*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |