Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0376900_circ_g.1 |
ID in PlantcircBase | osa_circ_020060 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 14880043-14881381 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0376900 |
Parent gene annotation |
Nucleotide-binding, alpha-beta plait domain containing protein. (Os03t0376900-01);Nucleotide-binding, alpha-beta plait domain co ntaining protein. (Os03t0376900-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0376900-02:4 Os03t0376900-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.221762827 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14880068-14880151(+) |
Potential amino acid sequence |
MVSYFASSSEPAQIRGKTVYIQYSNRQEIVNNKSPGETAGNVLLVTIEGVQANDVTIDVIHLVF SAFGFVHKIATFEKAAGFQALIQYTDAATASAAREALDGRSIPRYLLPEHVTSCCLRISFSAHK DLNIKFQSHRSRLTLIKLFRWFLTLHHLRNQRKSEAKLFTFSIQTDKK*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |