Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G53170_circ_g.15 |
ID in PlantcircBase | ath_circ_043855 |
Alias | At_ciR3315 |
Organism | Arabidpsis thaliana |
Position | chr5: 21565172-21565896 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | AT5G53170 |
Parent gene annotation |
ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitoch ondrial |
Parent gene strand | - |
Alternative splicing | AT5G53170_circ_g.1 AT5G53170_circ_g.2 AT5G53170_circ_g.3 AT5G53170_circ_g.4 AT5G53170_circ_g.5 AT5G53170_circ_g.6 AT5G53170_circ_g.7 AT5G53170_circ_g.8 AT5G53170_circ_g.9 AT5G53170_circ_g.10 AT5G53170_circ_g.11 AT5G53170_circ_g.12 AT5G53170_circ_g.13 AT5G53170_circ_g.14 AT5G53170_circ_g.16 AT5G53170_circ_g.17 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT5G53170.1:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.23953407 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21565376-21565174(-) |
Potential amino acid sequence |
MFVGVGARRVRSLFQAAKKKNVKTFKDVKGCDDAKQELEEVVEYLKNPSKFTRLGGKLPKGILL TGAPGTGKTLLAKAIAGEAGVPFFYRAGSEFEEMFVGVGARRVRSLFQAAKKKNVKTFKDVKGC DDAKQELEEVVEYLKNPSKFTRLGGKLPKGILLTGAPGTGKTLLAKAIAGEAGVPFFYRAGSEF EEMFVGVGARRVRSLFQAAKKKNVKTFKDVKGCDDAKQELEEVVEYLKNPSKFTRLGGKLPKGI LLTGAPGTGKTLLAKAIAGEAGVPFFYRAGSEFEEMFVGVGARRVRSLFQAAKKK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |