Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0153400_circ_g.3 |
| ID in PlantcircBase | osa_circ_000380 |
| Alias | Os_ciR6041 |
| Organism | Oryza sativa |
| Position | chr1: 2879553-2880434 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0153400 |
| Parent gene annotation |
Similar to tRNA synthetase class II (D, K and N) family protein. (Os01t0153400-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0153400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.235986546 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2879590-2880431(+) |
| Potential amino acid sequence |
MFEWNSDEQRYEALHHPFTAPNPEDMNDLPSARALAYDMIYNGVESAHSILWVTDFPMFEWNSD EQRYEALHHPFTAPNPEDMNDLPSARALAYDMIYNGVESAHSILWVTDFPMFEWNSDEQRYEAL HHPFTAPNPEDMNDLPSARALAYDMIYNGVESAHSILWVTDFPMFEWNSDEQRYEALHHPFTAP NPEDMNDLPSARALAYDMIYNGVE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |