Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0760600_circ_g.2 |
| ID in PlantcircBase | osa_circ_003975 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 32001306-32002154 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0760600 |
| Parent gene annotation |
Aspartate aminotransferase, cytoplasmic (EC 2.6.1.1) (Transamina se A). (Os01t0760600-01);Aspartate aminotransferase, cytoplasmic (EC 2.6.1.1) (Transaminase A). (Os01t0760600-02);Aspartate amin otransferase, cytoplasmic (EC 2.6.1.1) (Transaminase A). (Os01t0 760600-03);Similar to Aspartate aminotransferase. (Os01t0760600- 04) |
| Parent gene strand | - |
| Alternative splicing | Os01g0760600_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0760600-02:4 Os01t0760600-03:4 Os01t0760600-01:4 Os01t0760600-04:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.25079257 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32001883-32001341(+) |
| Potential amino acid sequence |
MAGLSAPKISLALSLLKSASPVIGKYSLTRDLISAIKEWQQCF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |