Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G19715_circ_g.2 |
ID in PlantcircBase | ath_circ_003443 |
Alias | At_ciR908, Ath_circ_FC0434, Ath_circ_FC0435 |
Organism | Arabidpsis thaliana |
Position | chr1: 6818250-6818483 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT1G19715 |
Parent gene annotation |
Jacalin-related lectin 3 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 7 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G19715.1:1 AT1G19715.2:1 AT1G19715.3:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.562680341 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6818400-6818252(-) |
Potential amino acid sequence |
MFDDGIYTGIRQINLSRNVGIVSMKVCYDFRGQAVWGSKHGGVGGFKHDKLVTDTEKSQSKIEG GAKTYGPWGGTGGIMFDDGIYTGIRQINLSRNVGIVSMKVCYDFRGQAVWGSKHGGVGGFKHDK LVTDTEKSQSKIEGGAKTYGPWGGTGGIMFDDGIYTGIRQINLSRNVGIVSMKVCYDFRGQAVW GSKHGGVGGFKHDKLVTDTEKSQSKIEGGAKTYGPWGGTGGIMFDDGIYTGIRQINLSRNVGIV SMKVCYDFRGQAVWGSKHGGVGGFKHDK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chen et al., 2017a |