Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0287300_circ_g.2 |
| ID in PlantcircBase | osa_circ_038747 |
| Alias | Os09circ02095/Os_ciR12011 |
| Organism | Oryza sativa |
| Position | chr9: 6436506-6437501 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os09g0287300 |
| Parent gene annotation |
Similar to predicted protein. (Os09t0287300-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4/2/1 |
| Tissues | leaf and panicle/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0287300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007994* osi_circ_018885 |
| PMCS | 0.289044867 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6437498-6436759(+) 6437435-6437486(-) |
| Potential amino acid sequence |
MISTHDFPSASSNAALHVLSTTESPENIEAASSHPLLCPIHITVRISSLEY*(+) MGWIPELVLCSDATRTKETLKILQDHVKGLSEAIVHFIPSFYSIAAMDGQTAEHLQKAICQYSS DEILTVMCMGHNKGWEEAASMFSGDSVVLKTCNAALLEAEGKSWVEIMTDL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |