Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0287300_circ_g.2 |
ID in PlantcircBase | osa_circ_038747 |
Alias | Os09circ02095/Os_ciR12011 |
Organism | Oryza sativa |
Position | chr9: 6436506-6437501 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
Parent gene | Os09g0287300 |
Parent gene annotation |
Similar to predicted protein. (Os09t0287300-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 4/2/1 |
Tissues | leaf and panicle/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0287300-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007994* osi_circ_018885 |
PMCS | 0.289044867 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6437498-6436759(+) 6437435-6437486(-) |
Potential amino acid sequence |
MISTHDFPSASSNAALHVLSTTESPENIEAASSHPLLCPIHITVRISSLEY*(+) MGWIPELVLCSDATRTKETLKILQDHVKGLSEAIVHFIPSFYSIAAMDGQTAEHLQKAICQYSS DEILTVMCMGHNKGWEEAASMFSGDSVVLKTCNAALLEAEGKSWVEIMTDL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |