Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0176401_circ_g.5 |
| ID in PlantcircBase | osa_circ_032962 |
| Alias | Os_ciR11240 |
| Organism | Oryza sativa |
| Position | chr7: 4024526-4024962 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os07g0176200 |
| Parent gene annotation |
Tesmin/TSO1-like, CXC domain containing protein. (Os07t0176200-0 1);Similar to Transcription factor CPP. (Os07t0176200-02) |
| Parent gene strand | + |
| Alternative splicing | Os07g0176401_circ_g.1 Os07g0176401_circ_g.2 Os07g0176401_circ_g.3 Os07g0176401_circ_g.4 Os07g0176401_circ_g.6 Os07g0176401_circ_g.7 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0176401-00:1 Os07t0176200-01:1 Os07t0176200-02:1 Os07t0176401-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.202638711 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4024551-4024712(+) 4024888-4024527(+) |
| Potential amino acid sequence |
MRRRCLVFEAAGYSNRIVQKESVMDLSVSTCKGKSPVQNHSNPGKTPSPRVLRGIGLHLNALAL TSKDKMICQDPMSSLVPSSATQQEAHGKMLSAGENFIHPGGELLELQMDDDCSAGVFLGNDHDS SQSNSPQKKRLRLNSNVACEDAVLFLRQLGTQIGLCRKNQSWICQSQPAKGKALYRITQIQGKL HLHVCCVV*(+) MMIVQLEFFLEMITIQVKATALKRRG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |