Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G08450_circ_g.6 |
| ID in PlantcircBase | ath_circ_001380 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 2669648-2669878 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT1G08450 |
| Parent gene annotation |
Calreticulin-3 |
| Parent gene strand | - |
| Alternative splicing | AT1G08450_circ_g.1 AT1G08450_circ_g.2 AT1G08450_circ_g.3 AT1G08450_circ_g.4 AT1G08450_circ_g.5 AT1G08450_circ_g.7 AT1G08450_circ_g.8 AT1G08450_circ_g.9 AT1G08450_circ_g.10 |
| Support reads | 1 |
| Tissues | root, aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G08450.3:2 AT1G08450.2:2 AT1G08450.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.211536944 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2669866-2669650(-) 2669850-2669875(+) |
| Potential amino acid sequence |
MIESTSMTPTMSNPRVLILFHVKFQIVKLKSQRTGMIESTSMTPTMSNPRVLILFHVKFQIVKL KSQRTGMIESTSMTPTMSNPRVLILFHVKFQIVKLKSQRTGMIESTSMTPTMSNPRVLILFHVK FQIVKLK(-) MYSLSSQSSGSLALRSGISRGIESKPSGLTSLGSSMYSLSSQSSGSLALRSGISRGIESKPSGL TSLGSSMYSLSSQSSGSLALRSGISRGIESKPSGLTSLGSSMYSLSSQSS(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |