Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G38170_circ_g.4 |
| ID in PlantcircBase | ath_circ_017185 |
| Alias | Ath_circ_FC4984 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 15990944-15991072 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT2G38170 |
| Parent gene annotation |
AT2G38170 protein |
| Parent gene strand | - |
| Alternative splicing | AT2G38170_circ_g.1 AT2G38170_circ_g.2 AT2G38170_circ_g.3 AT2G38170_circ_g.5 AT2G38170_circ_g.6 |
| Support reads | 131 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G38170.2:1 AT2G38170.1:1 AT2G38170.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.301525456 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15990995-15990946(-) |
| Potential amino acid sequence |
MTLVIALLSEYVVATIEEDEYDDDVEQETAVISFWSGFAWLVGMTLVIALLSEYVVATIEEDEY DDDVEQETAVISFWSGFAWLVGMTLVIALLSEYVVATIEEDEYDDDVEQETAVISFWSGFAWLV GMTLVIALLSEYVVATIE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |