Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G38170_circ_g.4 |
ID in PlantcircBase | ath_circ_017185 |
Alias | Ath_circ_FC4984 |
Organism | Arabidpsis thaliana |
Position | chr2: 15990944-15991072 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G38170 |
Parent gene annotation |
AT2G38170 protein |
Parent gene strand | - |
Alternative splicing | AT2G38170_circ_g.1 AT2G38170_circ_g.2 AT2G38170_circ_g.3 AT2G38170_circ_g.5 AT2G38170_circ_g.6 |
Support reads | 131 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G38170.2:1 AT2G38170.1:1 AT2G38170.3:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.301525456 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15990995-15990946(-) |
Potential amino acid sequence |
MTLVIALLSEYVVATIEEDEYDDDVEQETAVISFWSGFAWLVGMTLVIALLSEYVVATIEEDEY DDDVEQETAVISFWSGFAWLVGMTLVIALLSEYVVATIEEDEYDDDVEQETAVISFWSGFAWLV GMTLVIALLSEYVVATIE(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |