Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0350500_circ_g.3 |
ID in PlantcircBase | osa_circ_027500 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 16553969-16554594 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0350500 |
Parent gene annotation |
Peptidase M24, structural domain domain containing protein. (Os0 5t0350500-01) |
Parent gene strand | + |
Alternative splicing | Os05g0350500_circ_g.1 Os05g0350500_circ_g.2 Os05g0350500_circ_g.4 Os05g0350500_circ_g.5 Os05g0350500_circ_g.6 |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0350500-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015346 |
PMCS | 0.292271486 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16554510-16553968(+) 16554458-16554574(-) |
Potential amino acid sequence |
MLIRRWMMLNLRKMKCMQLILSPALEKGSDMGCHIDGFIAVVAHTHVIHDGAVTGKAADVLAAA NTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVEGVLSHQLKQFVIDGNKVVLSVSNADTK VDDAEFEENEVYAIDIVTSTGEGK*(+) MAENSFHNFAVISSSNFLNRFGDILVLLPRSNKPQSNFCRCVGSSKNICCFPSDCSIMDNMCMS HHGNKTINMTSHITSLLQCW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |