Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0350500_circ_g.3 |
| ID in PlantcircBase | osa_circ_027500 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 16553969-16554594 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0350500 |
| Parent gene annotation |
Peptidase M24, structural domain domain containing protein. (Os0 5t0350500-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0350500_circ_g.1 Os05g0350500_circ_g.2 Os05g0350500_circ_g.4 Os05g0350500_circ_g.5 Os05g0350500_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0350500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015346 |
| PMCS | 0.292271486 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16554510-16553968(+) 16554458-16554574(-) |
| Potential amino acid sequence |
MLIRRWMMLNLRKMKCMQLILSPALEKGSDMGCHIDGFIAVVAHTHVIHDGAVTGKAADVLAAA NTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVEGVLSHQLKQFVIDGNKVVLSVSNADTK VDDAEFEENEVYAIDIVTSTGEGK*(+) MAENSFHNFAVISSSNFLNRFGDILVLLPRSNKPQSNFCRCVGSSKNICCFPSDCSIMDNMCMS HHGNKTINMTSHITSLLQCW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |