Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0542100_circ_g.2 |
| ID in PlantcircBase | osa_circ_040075 |
| Alias | Os_ciR11922 |
| Organism | Oryza sativa |
| Position | chr9: 21349306-21349530 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os09g0542100 |
| Parent gene annotation |
Peptidase A1 domain containing protein. (Os09t0542100-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/2 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0542100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.247406444 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21349465-21349308(-) |
| Potential amino acid sequence |
MDSKSVPSLLASKGLAANSFSMCFGDDGHGRINFGDTGSSDQKETPLNVYKQNCGQVQTGSFLG SAAPNGLLGLGMDSKSVPSLLASKGLAANSFSMCFGDDGHGRINFGDTGSSDQKETPLNVYKQN CGQVQTGSFLGSAAPNGLLGLGMDSKSVPSLLASKGLAANSFSMCFGDDGHGRINFGDTGSSDQ KETPLNVYKQNCGQVQTGSFLGSAAPNGLLGLGMDSKSVPSLLASKGLAANSFSMCFGDDGHGR INFGDTGSSDQKETPLNVYKQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |