Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0555600_circ_g.1 |
| ID in PlantcircBase | osa_circ_024813 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 27808978-27809537 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0555600 |
| Parent gene annotation |
Similar to WD-40 repeat family protein / beige-related. (Os04t05 55600-01) |
| Parent gene strand | - |
| Alternative splicing | Os04g0555600_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0555600-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.374349792 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27809512-27809034(+) 27809494-27809491(-) 27809221-27809502(-) |
| Potential amino acid sequence |
MTASQKQKILILWSPVLDPPTIESHSAQ*(+) MTSISEWPEWILEVLIYNHEMGAKKYADGISIGDIEDLIHNFLIIMLEHSMRQKDGWKDVEATI HCAEWLSMVGGSSTGDQRIRIFCFWLAVIQRIEPR*(-) MGGRMWKQQFIVQSGFQWLEDLAQETKESGSSVFGLQSSRE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |