Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0683500_circ_g.1 |
| ID in PlantcircBase | osa_circ_026002 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 34893564-34895580 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0683500 |
| Parent gene annotation |
Similar to H0306F12.5 protein. (Os04t0683500-01);Similar to Aden osine deaminase acting on tRNA 1. (Os04t0683500-02);Similar to H 0306F12.5 protein. (Os04t0683500-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0683500-01:7 Os04t0683500-03:6 Os04t0683500-02:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.119492088 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34895317-34893618(+) 34895485-34894931(+) |
| Potential amino acid sequence |
MSYRQIKDMAHEYQQTLELLRKAPFFSRWSAKPASLDSFTVSRWSHACSTISLRVAQGTAG*(+ ) MNTSRHLSFSGRLHFLAGGVLSLHPSIHSRFHGGVMPVPPSPSELLREQLDSVNGCDDVGFVQR KPGRGDTTLSMSCFDKITRWSVVGIQGALLSHILEPLYLSTITIGQSPTGASDGFSVENNIKKV LDARLSSLSSKLLLPFKLNKPLFYEAPIPPKEFQQTSGDLQPLTCG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |