Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0596300_circ_g.3 |
| ID in PlantcircBase | osa_circ_034627 |
| Alias | Os_ciR3148 |
| Organism | Oryza sativa |
| Position | chr7: 24269954-24270270 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0596300 |
| Parent gene annotation |
Actin-binding FH2 domain containing protein. (Os07t0596300-01);C lass II formin, Type II formin, Actin organization, Morphogenesi s (Os07t0596300-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0596300-01:2 Os07t0596300-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.209715878 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24270005-24270014(+) 24270257-24270145(-) |
| Potential amino acid sequence |
MISFNLRELRISSHEESMVFKLFRRSATCEPNWILKENTRSFDSIRGTFINSRKNSSSTLVQCI PKEENFLHDFF*(+) MKVPRMESKLRVFSFKIQFGSQVADLRKSLNTIDSSCDEIRSSLKLKEIMKKILLLGNTLNQGT ARVLPRIDESATNGVKTAGVLLQDPVWFASRRSSKKFEHHRLFM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |