Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G45540_circ_g.23 |
| ID in PlantcircBase | ath_circ_018551 |
| Alias | AT2G45540_C1, AT2G45540_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 18769223-18770007 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT2G45540 |
| Parent gene annotation |
BEACH domain-containing protein C2 |
| Parent gene strand | - |
| Alternative splicing | AT2G45540_circ_g.22 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G45540.4:1 AT2G45540.1:1 AT2G45540.3:1 AT2G45540.5:1 AT2G45540.6:1 AT2G45540.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.370656998 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18769956-18770001(-) |
| Potential amino acid sequence |
MKPVESFWALAYGGPMSLLPLTVSSVHKDSLEPCLGNLPLSLSTVTLAAPVFRIMSVAIQHPGN NEELCRTQGPEILARILSYLLHSLASLDRKHDGVGEEELVAAIVSLCQSQKINHVLKVQLFRTL LLDLKIWSLCNYGLQKKLLSSLQDMVFTEATAMRDAEAIQLLLDGCRRCYWMISEKDSETTFPL DGNTRQMGELNALIDELLVIIELLMGAASPSLAADDLRRLLGFIIDSPQPNQAL* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |