Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0672300_circ_g.1 |
| ID in PlantcircBase | osa_circ_025907 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 34322293-34323301 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0672300 |
| Parent gene annotation |
Similar to H0322F07.3 protein. (Os04t0672300-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0672300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.327766145 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34323286-34322335(+) 34323297-34323294(-) |
| Potential amino acid sequence |
MLVIWPELQRTVGFSGGEPK*(+) MTSMDKAANVVLDIEGLPQQPDKCCTGSPKMTRALSRKGSNRMERRSGEEQEQDDLVKKLIIKV VPSQLEQLKMPLVQNKALVTPQSQCAACAPILTDSGEGRNKKFNRLTSVHPRKILLFFATLAR* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |