Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0268300_circ_g.1 |
ID in PlantcircBase | osa_circ_019069 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 8903818-8905000 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0268300 |
Parent gene annotation |
Similar to Digalactosyldiacylglycerol synthase 2. (Os03t0268300- 01);Similar to DGD2 (digalactosyldiacylglycerol synthase 2); dig alactosyldiacylglycerol synthase / transferase, transferring gly cosyl groups. (Os03t0268300-02) |
Parent gene strand | - |
Alternative splicing | Os03g0268300_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0268300-02:2 Os03t0268300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.162529839 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8904928-8903893(+) 8904010-8904849(-) 8903868-8904944(-) |
Potential amino acid sequence |
MSALSSDTVWVMSPAGRMLLFSVENHEIWNLHGHDQDRLEHQDLVSRLML*(+) MVWSKGYTELLQLLQKHQKELSGLKMELYGSGEDSDEVKASAEKLNLDVRVYPGRDHGDSIFHD SQRRKEAFYLLGTSPRLYLMIKQTLQFLKSQSILHGTIMDEGGKTNSEKL*(-) MFESILVVTMEIPYFMILNGEKKHSTCWGHHPDCI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |