Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0268300_circ_g.1 |
| ID in PlantcircBase | osa_circ_019069 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 8903818-8905000 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0268300 |
| Parent gene annotation |
Similar to Digalactosyldiacylglycerol synthase 2. (Os03t0268300- 01);Similar to DGD2 (digalactosyldiacylglycerol synthase 2); dig alactosyldiacylglycerol synthase / transferase, transferring gly cosyl groups. (Os03t0268300-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0268300_circ_g.2 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0268300-02:2 Os03t0268300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.162529839 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8904928-8903893(+) 8904010-8904849(-) 8903868-8904944(-) |
| Potential amino acid sequence |
MSALSSDTVWVMSPAGRMLLFSVENHEIWNLHGHDQDRLEHQDLVSRLML*(+) MVWSKGYTELLQLLQKHQKELSGLKMELYGSGEDSDEVKASAEKLNLDVRVYPGRDHGDSIFHD SQRRKEAFYLLGTSPRLYLMIKQTLQFLKSQSILHGTIMDEGGKTNSEKL*(-) MFESILVVTMEIPYFMILNGEKKHSTCWGHHPDCI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |