Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0401300_circ_g.3 |
ID in PlantcircBase | osa_circ_020221 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 16301984-16302228 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os03g0401300 |
Parent gene annotation |
Sucrose synthase 2 (EC 2.4.1.13) (Sucrose-UDP glucosyltransferas e 2). (Os03t0401300-01);Similar to Sucrose synthase 1. (Os03t040 1300-02);Similar to Sucrose synthase metabolism (Fragment). (Os0 3t0401300-03) |
Parent gene strand | - |
Alternative splicing | Os03g0401300_circ_g.4 Os03g0401300_circ_g.5 Os03g0401300_circ_g.6 Os03g0401300_circ_g.7 Os03g0401300_circ_g.8 Os03g0401300_circ_g.9 Os03g0401300_circ_g.10 Os03g0401300_circ_g.11 |
Support reads | 4 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0401333-00:1 Os03t0401300-03:1 Os03t0401300-01:1 Os03t0401333-00:1 Os03t0401300-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.463264354 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16302211-16301998(+) 16302188-16302185(-) |
Potential amino acid sequence |
MPRRKRVLLDTLKTALRDLGPVAGVFLALLKELNEQRRGLVTLVWVNVEARHSVHDDLSWTTIG GCECRETTGHGLNNSETECLVESGFSSIR*(+) MTCGLPTFATAYGGPAEIIVNGVSGFHIDPYQGDKASALLVEFFEKCQEDPSHWTKISQGGLQR IEENPLSTRHSVSLLLSP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |