Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA020909_circ_g.1 |
| ID in PlantcircBase | osi_circ_006825 |
| Alias | 6:25296014|25297607 |
| Organism | Oryza sativa ssp. indica |
| Position | chr6: 25296014-25297607 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA020909 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA020909_circ_igg.1 BGIOSGA020909_circ_igg.2 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA020909-TA:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25297080-25297493(-) 25297577-25296044(+) |
| Potential amino acid sequence |
MIETAIGIVDSTGGQYHVLLIIADGQVTRSVDTQSGQLSPQERDTIDAIVKASQFPLSIVLVGV GDGPWDMMHQFDDNIPARSFDNFQFVNFTDIMSKSIAADRKEAEFALSALMEIPTQYKATLDLQ LLGRRQRIQPRIPLPPPMRNAYSRSTSFDQHSGVYSRSSSFGPQTSGFQQSESFKQRQPVATTA PDTYTSESSLEGRLVNFPSIADVCMILETLQIHMSKQYLLLEGHFQLLMKII*(-) MQTSAIEGKFTSLPSKELSEV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |