Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0750300_circ_g.1 |
| ID in PlantcircBase | osa_circ_003896 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 31424609-31424875 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0750300 |
| Parent gene annotation |
Similar to Cellulose synthase (Fragment). (Os01t0750300-01);Simi lar to cDNA clone:J023093O20, full insert sequence. (Os01t075030 0-02);Similar to cDNA clone:J023093O20, full insert sequence. (O s01t0750300-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 10 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0750300-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.464646223 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31424692-31424872(+) |
| Potential amino acid sequence |
MRLVVLGLFFHYRITNPVYSAFGLWMTSVICEIWFGFSWILDQFPKWCPINRETYVDRLIARLT DAYEPLSRIIPISKNKLTPYRAVIIMRLVVLGLFFHYRITNPVYSAFGLWMTSVICEIWFGFSW ILDQFPKWCPINRETYVDRLIARLTDAYEPLSRIIPISKNKLTPYRAVIIMRLVVLGLFFHYRI TNPVYSAFGLWMTSVICEIWFGFSWILDQFPKWCPINRETYVDRLIARLTDAYEPLSRIIPISK NKLTPYRAVIIMRLVVLGLFFHYRITNPVYSAFGLWMTSVICEIWFGFSWILDQFPKWCPINRE TYVDRLIA(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |