Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d053076_circ_g.3 |
ID in PlantcircBase | zma_circ_008243 |
Alias | Zm04circ00089, GRMZM2G071023_C1 |
Organism | Zea mays |
Position | chr4: 212553865-212554190 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d053076 |
Parent gene annotation |
NAD kinase 2 chloroplastic |
Parent gene strand | + |
Alternative splicing | Zm00001d053076_circ_g.2 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d053076_T002:1 Zm00001d053076_T010:1 Zm00001d053076_T003:2 Zm00001d053076_T001:1 Zm00001d053076_T011:1 Zm00001d053076_T005:1 Zm00001d053076_T014:1 Zm00001d053076_T007:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.228462601 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
212554084-212554064(+) 212553915-212554098(-) |
Potential amino acid sequence |
MPVGARTRGTSGSEKASHWAGARGATWRKGASGTETVQADGVIVATPTGSTAYSTAAGGSMDCY N*(+) MLCCQLVLQLSPRQLAQFQSPRHLCAMWHLLPQPNGTPSRTLRFLLS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |