Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0100500_circ_g.2 |
| ID in PlantcircBase | osa_circ_035511 |
| Alias | Os_ciR2062 |
| Organism | Oryza sativa |
| Position | chr8: 40597-41153 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os08g0100500 |
| Parent gene annotation |
Regulation of nuclear pre-mRNA protein domain containing protein . (Os08t0100500-01);Conserved hypothetical protein. (Os08t010050 0-02);Hypothetical conserved gene. (Os08t0100500-03) |
| Parent gene strand | + |
| Alternative splicing | Os08g0100500_circ_g.1 |
| Support reads | 11/4 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0100500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007476* osi_circ_018262 |
| PMCS | 0.570264273 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
40997-40615(+) 41106-40628(+) 40681-41116(-) |
| Potential amino acid sequence |
MPEGILRRYMDDIEVPNDDANTGFLLRRPSRAERSVDDPIREMEGMLVDEYGRLWSFLC*(+) MILLGRWKACLLMSMEDCGASCAEIRE*(+) MESIRKRRSTLRCKLGSFSNFSTRSSTIFHTHQQACLPSP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |