Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0100500_circ_g.2 |
ID in PlantcircBase | osa_circ_035511 |
Alias | Os_ciR2062 |
Organism | Oryza sativa |
Position | chr8: 40597-41153 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
Parent gene | Os08g0100500 |
Parent gene annotation |
Regulation of nuclear pre-mRNA protein domain containing protein . (Os08t0100500-01);Conserved hypothetical protein. (Os08t010050 0-02);Hypothetical conserved gene. (Os08t0100500-03) |
Parent gene strand | + |
Alternative splicing | Os08g0100500_circ_g.1 |
Support reads | 11/4 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0100500-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007476* osi_circ_018262 |
PMCS | 0.570264273 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
40997-40615(+) 41106-40628(+) 40681-41116(-) |
Potential amino acid sequence |
MPEGILRRYMDDIEVPNDDANTGFLLRRPSRAERSVDDPIREMEGMLVDEYGRLWSFLC*(+) MILLGRWKACLLMSMEDCGASCAEIRE*(+) MESIRKRRSTLRCKLGSFSNFSTRSSTIFHTHQQACLPSP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |