Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.011G222500_circ_g.1 |
| ID in PlantcircBase | gra_circ_001247 |
| Alias | Chr11:53132374|53133430 |
| Organism | Gossypium raimondii |
| Position | chrChr11: 53132374-53133430 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.011G222500 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 15/5 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.011G222500.2:3 Gorai.011G222500.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000374* gar_circ_000445* |
| PMCS | 0.941062914 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
53132978-53132380(+) 53132379-53133312(-) |
| Potential amino acid sequence |
MVASQGITIDSVGDYIAQGAISVVLSDAIFDKEAMSQNNFDVVNRLATSAALQGKTAVERTF*( +) MSFLQQFCPAKLQMWQVDLRHQSCFGSSPPYRKWHPIKRLI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |