Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0232700_circ_g.3 |
| ID in PlantcircBase | osa_circ_000965 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 7350620-7350679 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0232700 |
| Parent gene annotation |
Similar to Histidinol dehydrogenase, chloroplast precursor (EC 1 .1.1.23) (HDH). Splice isoform 2. (Os01t0232700-01);Similar to H istidinol dehydrogenase. (Os01t0232700-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0232700-01:1 Os01t0232700-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.151386806 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7350669-7350676(+) |
| Potential amino acid sequence |
MILQVEKIFGPGNQYVTAAKMILQVEKIFGPGNQYVTAAKMILQVEKIFGPGNQYVTAAKMILQ (+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |