Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_20G072600_circ_g.2 |
| ID in PlantcircBase | gma_circ_005158 |
| Alias | Gm20circRNA1431 |
| Organism | Glycine max |
| Position | chr20: 25675333-25689898 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat, CIRI |
| Parent gene | GLYMA_20G072600 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | GLYMA_20G072600_circ_ag.1 GLYMA_20G072600_circ_ag.2 GLYMA_20G072700_circ_g.1 GLYMA_20G072700_circ_g.2 GLYMA_20G072700_circ_g.3 |
| Support reads | NA |
| Tissues | root, stem |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRG90169:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.139433623 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25689685-25675345(+) |
| Potential amino acid sequence |
MRPSAASPGRDGDPNGKNHSSNFHSELHKNNADAVQYTLPVLIPPRILPLLNNLTQQMVQAGHQ QQLLKAYRQKQK*(+) |
| Sponge-miRNAs | gma-miR1533 gma-miR1535a gma-miR10420 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a |