Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_14G012300_circ_g.1 |
| ID in PlantcircBase | gma_circ_007041 |
| Alias | gma-circRNA2045 |
| Organism | Glycine max |
| Position | chr14: 929556-929859 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_14G012300 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRH14204:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.073476234 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
929855-929856(+) 929592-929677(-) |
| Potential amino acid sequence |
MQIEEYFSAKGLNIVGYFHANERSDDNELGGVAKNIGDHICRYFPEAAVLLLDNKKLDALKKSK DRSAIMQIEEYFSAKGLNIVGYFHANERSDDNELGGVAKNIGDHICRYFPEAAVLLLDNKKLDA LKKSKDRSAIMQIEEYFSAKGLNIVGYFHANERSDDNELGGVAKNIGDHICRYFPEAAVLLLDN KKLDALKKSKDRSAIMQ(+) MFNPLAEKYSSICIMALRSLLFFKASSFLLSNNRTAASGK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | cytoplasmic male sterility |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |