Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G10260_circ_g.3 |
ID in PlantcircBase | ath_circ_020800 |
Alias | AT3G10260_C2, AT3G10260_C2 |
Organism | Arabidpsis thaliana |
Position | chr3: 3171847-3172253 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT3G10260 |
Parent gene annotation |
Reticulon family protein |
Parent gene strand | - |
Alternative splicing | AT3G10260_circ_g.1 AT3G10260_circ_g.2 AT3G10260_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G10260.3:2 AT3G10260.2:2 AT3G10260.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.44352811 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3172205-3172205(-) |
Potential amino acid sequence |
MGATAIWVLFEWINFHFLSLVCYALLLGMIAQFVWSNASGFLNRSQSRVPRLVLPKDFFAEVGV AVGKEVNRGLLFLQDLACKGNLKQFLMLLMCCYGGTRRSLQVF* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |