Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_17G209600_circ_g.2 |
| ID in PlantcircBase | gma_circ_004556 |
| Alias | Gm17circRNA375, gma-circRNA2380 |
| Organism | Glycine max |
| Position | chr17: 34578204-34579654 JBrowse» |
| Reference genome | v2.0.38 |
| Type | ue-circRNA |
| Identification method | Tophat, CIRI, find_circ |
| Parent gene | GLYMA_17G209600 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_17G209600_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH05146:4 KRH05140:4 KRH05145:4 KRH05143:4 KRH05142:4 KRH05138:4 KRH05135:4 KRH05134:4 KRH05137:4 KRH05136:4 KRH05139:4 KRH05141:4 KRH05147:3 KRH05144:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.306709224 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34579579-34578237(+) 34579648-34579642(-) |
| Potential amino acid sequence |
MKVIPSSMFYNSFGGTIKHVHQHCLPWFSDFCAIKRR*(+) MLMDMFYSATKGIVKHRRRYHFHEAMLRINEQMHKIWKNQIEEKPLQSTIAGWIMSLPFDTKAK EWLAAEERYKQEVQMKNILPAVADMFFLDGEENEKGASILCFDEIQTVDVFAIVALSGILSRLL SSGTIIVATSNRAPKDLNEAGMQKEIFQKLVSKLEEHCEKVLIGSEIDYRRFIAQKSENQGRQC *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a; Chen et al., 2018 |